- Recombinant Variola virus Late protein H2 (H2R, I2R)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1164173
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 21,509 Da
- E Coli or Yeast
- 1-189
- Late protein H2 (H2R, I2R)
Sequence
MDKTTLSVNACNLEYVREKAIVGVQAAKTSTLIFFVIILAISALLLWFQTSDNPVFNELTRYMRIKNTVNDWKSLTDSKTKLESDRGRLLAAGKDDIFEFKCVDFGAYFIAMRLDKKTYLPQAIRRGTGDAWMVKKAAKVDPSAQQFCQYLIKHKSNNVITCGNEMLNELGYSGYFMSPHWCSDLSNME